← themes
Idiosyncratic & one-offs
appeared in 37 sessions · 35 labels · 96 names · 2026-06-29 → 2026-09-10
One driver, every session the wrap named it in — newest first. The wrap writes its own heading each day, so the wording below changes constantly while the driver underneath doesn't.
What it's been called
Idiosyncratic Bright SpotsIdiosyncratic DisappointmentsRegulatory and Industrial DislocationsCorporate Actions & Platform ReboundsCorporate Actions & Busted DealsIdiosyncratic & Consumer MoversIdiosyncratic & Regulatory ShocksUK Corporate Action & Pricing AnomaliesIdiosyncratic RecoveriesIdiosyncratic Reversals & ClearancesIdiosyncratic Shifts & Index MechanicsConsumer Breakdown & Idiosyncratic ReversalsIdiosyncratic Movers & Index MechanicsIndex Events & Idiosyncratic MoversSector Outliers & Fundamental ExecutionNotable One-OffsIdiosyncratic ExecutionRelief Rallies & Capital PenaltiesCyclical Stumbles & Corporate ActionsEarnings Resilience & Unchanged GuidanceIdiosyncratic Turnarounds & Execution WinsIdiosyncratic DivergenceIdiosyncratic Legal ShockLogistics, Telecom, and Idiosyncratic MoversIdiosyncratic Meltdowns and Legal ShocksNotable OutliersEarnings Divergence and Operational StumblesEarnings Shocks and Sector RotationsStandout Earnings, Upgrades, and One-OffsNotable Idiosyncratic MoversUK Blue-Chip DisruptionsNotable Single-Stock DisconnectsNotable Single-Stock MoversNotable Standouts and One-OffsCorporate Catalysts and Governance Risks
Names in this category
AXON×7MRNA×7RDDT×5CHRW×4CHTR×4CVNA×4MNST×4COIN×3CPRT×3HONA×3IGG.L×3TSLA×3VOD.L×3ABNB×2ANTO.L×2APTV×2AZN.L×2DXCM×2FDXF×2GRMN×2MPC×2MRO.L×2MSCI×2PNR×2SMCI×2STJ.L×2SWKS×2TPR×2TTD×2ABTAIZAKAMALGNAPPAREARESBABAXBGEO.LBKNGBRBY.LCASYCBOECLXCMGCNA.LCOOCRDA.LCTSHDASHDHRDVAEDV.LEIXELEOGEXPEFICOFSLRGDDYGNRCGPNGSHASHRLHSTHWMIBMIII.LIPISRGIVZLDOSNFLXOXYPANWPCGPODDPSH.LPSON.LPSXPYPLREL.LROLSRESTZSWSYFTPLTRMBTRVTTWOUBERVTRSWSTXYZ
Idiosyncratic Bright Spots
Idiosyncratic Disappointments
COOThe Cooper Companies, Inc.COO stock fell after missing Q3 revenue expectations, lowering full-year guidance due to channel destocking, and ending a strategic review.IPInternational Paper CompanyThe stock plunged due to Canadian retaliatory tariffs, surging crude oil prices, rising Treasury yields, and dividend safety concerns.
Regulatory and Industrial Dislocations
FICOFair Isaac CorporationThe FHFA directed Fannie Mae and Freddie Mac to immediately allow mortgage lenders to use the competing VantageScore 4.0 credit model.HWMHowmet Aerospace Inc.Shares fell after SpaceX announced plans to manufacture its own turbine components, threatening Howmet's dominant market position.
Corporate Actions & Platform Rebounds
TTDThe Trade Desk, Inc.The stock surged due to an FTC lawsuit against Amazon ad practices, the launch of its Kokai Zuma AI platform, and short covering.RDDTReddit, Inc.Reddit stock surged after a Baird research note argued the market had over-discounted risks from expiring AI data licensing deals.CHTRCharter Communications, Inc.Shares rebounded as investors bought the dip after Charter reaffirmed its financial outlook following an executive CFO transition.SWKSSkyworks Solutions, Inc.Skyworks revealed an over 90% tender acceptance rate for its debt exchange offers related to its pending merger with Qorvo.XYZBlock, Inc.The stock surged due to Ark Invest's $37.4M buy disclosure and Block opening its Cash App Score credit model to external lenders.EDV.LEndeavour Mining plcThe stock fell due to a spot gold sell-off triggered by rising bond yields, hawkish Fed remarks, and an RBC price target reduction.
Corporate Actions & Busted Deals
Idiosyncratic & Consumer Movers
CASYCasey's General Stores, Inc.The stock fell due to valuation recalibrations, an analyst price target trim, insider share sales, and pre-earnings de-risking.CLXThe Clorox CompanyHeavy option put buying and Wall Street target cuts following margin contraction and flat organic growth drove the stock lower.TTWOTake-Two Interactive Software, Inc.Take-Two shares fell due to unauthorized Grand Theft Auto VI gameplay leaks and an escalating cybersecurity breach.TSLATesla, Inc.Tesla stock surged due to hype ahead of its Cybercab launch event and Texas regulatory filings confirming autonomous fleet registrations.COINCoinbase Global, Inc.The stock surged due to Wall Street analyst price target upgrades and major operational expansion announcements.
Idiosyncratic & Regulatory Shocks
UK Corporate Action & Pricing Anomalies
Idiosyncratic Recoveries
CRDA.LCroda International PlcShares surged due to pre-ex-dividend accumulation, an institutional investor site visit, and a technical breakout to new 52-week highs.MRO.LMelrose Industries PLCMelrose announced the closure of a US criminal probe without charges, a $100M claims framework, and a September restart target.CHRWC.H. Robinson Worldwide, Inc.The stock surged due to an oversold technical breakout and analyst notes showing the market overreacted to a non-final legal verdict.
Idiosyncratic Reversals & Clearances
ELThe Estée Lauder Companies Inc.The stock surged following fiscal Q4 2026 earnings and revenue beats along with raised fiscal 2027 guidance and margin outlook.CVNACarvana Co.Carvana surged after clearing insider overhang fears, refinancing debt to save $45M in interest, and announcing a new expansion.AREAlexandria Real Estate Equities, Inc.The stock surged following Treasury bond buybacks, a $1.0B debt offering, and insider buying after an oversold earnings reaction.MRO.LMelrose Industries PLCNo criminal charges were filed regarding a California chemical incident, capping liability and setting a plant reopening date.
Idiosyncratic Shifts & Index Mechanics
RDDTReddit, Inc.Shares fell due to a sell-the-news event following S&P 500 inclusion mechanics combined with insider selling disclosures.SRESempraRising Treasury yields, a Morgan Stanley price target cut, and a $500M debt issuance triggered a 5.14% decline in Sempra stock.TSLATesla, Inc.Nevada regulators authorized Tesla to launch a commercial driverless Robotaxi service with up to 5,000 vehicles in Clark County.
Consumer Breakdown & Idiosyncratic Reversals
TPRTapestry, Inc.Tapestry issued softer-than-expected FY27 guidance and reported a revenue drop at Kate Spade despite beating Q4 earnings.ANTO.LAntofagasta plcThe stock dropped after the company cut FY2026 copper production guidance due to weather disruptions and reported higher-than-expected net debt.BRBY.LBurberry Group plcThe stock fell due to broker valuation warnings, price target cuts, and Middle East geopolitical tensions threatening luxury tourism.CVNACarvana Co.Carvana fell due to fears that insider Mark Walter may liquidate his $2B stake amid a federal probe, alongside director insider sales.PODDInsulet CorporationThe stock rebounded due to an oversold mean-reversion bounce and valuation re-rating following an aggressive post-earnings selloff.
Idiosyncratic Movers & Index Mechanics
MNSTMonster Beverage CorporationThe stock price halved due to a 2-for-1 stock split that took effect on August 11, 2026.TPRTapestry, Inc.TPR fell after softer FY2027 revenue guidance and ongoing Kate Spade sales declines overshadowed strong Q4 earnings.PSXPhillips 66The stock surged due to strong Q2 earnings, a $10B buyback plan, accelerated debt reduction, and a $5B pipeline investment decision.RDDTReddit, Inc.Reddit fell due to a sell-the-news unwind ahead of its S&P 500 inclusion, amplified by disclosures of planned insider stock sales.CVNACarvana Co.Shares fell due to insider selling disclosures, profit-taking after a debt refinancing rally, and a spike in benchmark Treasury yields.STZConstellation Brands, Inc.Berkshire Hathaway completely liquidated its stake in Constellation Brands, driving a sharp institutional sell-off.ALGNAlign Technology, Inc.The stock fell due to a UK VAT ruling causing a $37.5M liability and 20% tax charge, alongside bearish DCF valuation models.
Index Events & Idiosyncratic Movers
MNSTMonster Beverage CorporationThe stock dropped due to a mechanical price adjustment from a 2-for-1 stock split along with minor post-earnings profit-taking.RDDTReddit, Inc.Reddit stock surged after S&P Dow Jones Indices announced the company will be added to the flagship S&P 500 Index.CPRTCopart, Inc.The stock surged due to a technical breakout catalyzed by institutional accumulation disclosures and leadership stabilization.ANTO.LAntofagasta plcAntofagasta cut full-year copper production guidance by 5% and raised cost guidance following severe winter storm disruptions in Chile.GDDYGoDaddy Inc.GoDaddy shares fell due to profit-taking, executive insider stock sales, and rising legal notices over domain pricing disclosures.BGEO.LLion Finance Group PLCThe stock surged following strong Q2 earnings, an extended share buyback with an interim dividend, and a JPMorgan price target hike.
Sector Outliers & Fundamental Execution
MPCMarathon Petroleum CorporationThe stock surged following blockbuster Q2 earnings, analyst upgrades, and macro tailwinds from potential Russian product export cuts.MRNAModerna, Inc.Moderna surged after FDA approval of its mRNA flu vaccine, a Q2 earnings beat, and a $200 million reduction in operating expenses.FDXFFedEx Freight Holding Company, Inc.Shares surged after management gave reassuring margin commentary at an industry summit and market digested post-spinoff filings.GPNGlobal Payments Inc.Shares surged following analyst upgrades, short-covering, a technical breakout, and soft U.S. PPI inflation data.
Notable One-Offs
Idiosyncratic Execution
MNSTMonster Beverage CorporationThe stock moved following a 2-for-1 stock split distribution and Q2 earnings beating consensus estimates with record quarterly revenue.TTDThe Trade Desk, Inc.The stock fell after missing Q2 2026 revenue and EPS estimates and issuing weak Q3 guidance.ABNBAirbnb, Inc.Airbnb reported strong Q2 2026 earnings that beat consensus estimates and raised its full-year 2026 financial outlook.HONAHoneywell Aerospace Inc.Honeywell Aerospace missed Q2 earnings consensus and slashed its full-year 2026 guidance due to supply chain bottlenecks.LDOSLeidos Holdings, Inc.Leidos stock surged after reporting strong Q2 FY2026 earnings beats, record cash flow, and raising its full-year 2026 guidance.
Relief Rallies & Capital Penalties
IGG.LIG Group Holdings plcIG Group fell after reporting margin compression, acquiring Underdog Sports for $1.3B, and canceling its £125M share buyback.ABNBAirbnb, Inc.Airbnb surged after beating Q2 2026 earnings estimates and raising its full-year revenue and EBITDA margin guidance.HONAHoneywell Aerospace Inc.The stock rebounded on an oversold bounce and institutional buying after a severe drop driven by a Q2 earnings miss and guidance cut.APTVAptiv PLCShares surged on an oversold technical bounce, institutional value buying, and an options volatility squeeze following earnings.AKAMAkamai Technologies, Inc.Akamai fell as margin compression, heavy GPU CapEx guidance, and paused buybacks offset Q2 earnings beats and a $600M cloud deal.UBERUber Technologies, Inc.Uber stock surged following Wall Street analyst defenses and Bill Ackman's endorsement after an oversold Q2 earnings selloff.
Cyclical Stumbles & Corporate Actions
DVADaVita Inc.The stock fell after DaVita merely reaffirmed guidance despite Q2 beats and warned of lower revenue per treatment from payer mix shifts.HONAHoneywell Aerospace Inc.HONA missed Q2 earnings estimates, lowered full-year guidance, and reported unexpected separation charges.IGG.LIG Group Holdings plcIG Group dropped after cancelling its £125m buyback to fund a $1.3B acquisition of Underdog Sports amidst margin compression.APTVAptiv PLCAptiv cut its full-year 2026 guidance in its Q2 release due to a slump in China auto sales, program delays, and negative free cash flow.VTRSViatris Inc.Shares fell after a widening GAAP net loss from a $177.8M impairment charge and supply chain constraints offset an adjusted earnings beat.HSTHost Hotels & Resorts, Inc.Shares dropped on a sell-the-news reaction citing transient night contraction, margin headwinds, Hawaii storm costs, and deferred condo profits.TPLTexas Pacific Land CorporationThe stock fell after Q2 2026 revenue missed Wall Street estimates due to a 19% decline in water sales volume and lower land sales.
Earnings Resilience & Unchanged Guidance
AIZAssurant, Inc.Assurant stock surged due to strong Q2 2026 earnings and revenue beats along with a full-year guidance upgrade.BKNGBooking Holdings Inc.The stock surged after reporting Q2 2026 beats on revenue, gross bookings, and EPS alongside raised annual cost-savings targets.EOGEOG Resources, Inc.The stock fell after management kept full-year guidance unchanged despite beating Q2 estimates and signaled flat Permian volume growth.
Idiosyncratic Turnarounds & Execution Wins
GRMNGarmin Ltd.Garmin reported record Q2 2026 earnings with EPS and revenue beating estimates, and raised its full-year 2026 guidance.BAXBaxter International Inc.Baxter reported a Q2 2026 earnings beat, raised its full-year guidance, and benefited from a one-time tariff refund.DXCMDexCom, Inc.DexCom stock surged after reporting strong Q2 2026 earnings beats, raising full-year guidance, and showing margin expansion.FSLRFirst Solar, Inc.First Solar stock surged after beating Q2 2026 EPS estimates and receiving a series of analyst price target upgrades.ARESAres Management CorporationARES surged due to record Q2 2026 financial results, including record $36.4B fundraising, and a wave of Wall Street analyst upgrades.BAThe Boeing CompanyBoeing stock rose after receiving FAA certification for its 737 MAX 7 alongside a double upgrade from BNP Paribas.
Idiosyncratic Divergence
GRMNGarmin Ltd.Garmin reported blowout Q2 2026 earnings and revenue, raised full-year guidance, and announced key software acquisitions.CHTRCharter Communications, Inc.Shares surged following a post-earnings value rebound, an EPS beat, strong mobile line additions, and a $3.5 billion debt exchange offer.CMGChipotle Mexican Grill, Inc.Chipotle stock surged after reporting strong Q2 2026 earnings and revenue beats and raising its full-year same-store sales guidance.IGG.LIG Group Holdings plcIG Group paused its share buyback program to fund a $1.1B acquisition of Underdog while H1 EBITDA margins compressed.DXCMDexCom, Inc.DexCom stock surged after beating Q2 2026 revenue and EPS estimates and raising its full-year guidance.COINCoinbase Global, Inc.Coinbase stock dropped after Q2 2026 earnings missed expectations due to a 20-25% slump in crypto spot trading volumes.REL.LRELX PLCThe stock dropped due to month-end institutional portfolio rebalancing, sector rotation into cyclicals, and post-earnings profit-taking.EIXEdison InternationalEIX fell on a Q2 revenue miss, wildfire liability and credit downgrade warnings, and an analyst downgrade by Barclays.
Idiosyncratic Legal Shock
Logistics, Telecom, and Idiosyncratic Movers
CHRWC.H. Robinson Worldwide, Inc.Shares fell after an advisory jury awarded $604 million in damages against C.H. Robinson in a negligent carrier selection lawsuit.TRMBTrimble Inc.The stock surged on T&L division sale rumors, heavy institutional buying disclosed in 13F filings, and pre-earnings short-covering.EXPEExpedia Group, Inc.Shares surged due to pre-earnings analyst upgrades, an exclusive distribution deal with Allegiant, and institutional short covering.CHTRCharter Communications, Inc.Shares rebounded as investors digested a strong Q2 earnings beat, robust mobile growth, and solid free cash flow post-selloff.DASHDoorDash, Inc.The stock surged due to a delivery fee overhaul, major institutional stake disclosures, and pre-earnings drone delivery speculation.CPRTCopart, Inc.The stock surged due to technical oversold signals, institutional disclosures, and short covering ahead of an upcoming CEO transition.
Idiosyncratic Meltdowns and Legal Shocks
ROLRollins, Inc.The stock dropped due to a Q2 earnings and revenue miss, lowered full-year organic growth guidance, and operating margin compression.MRNAModerna, Inc.Moderna fell due to escalating patent litigation with Sanofi and CureVac, valuation concerns ahead of Q2 earnings, and insider selling.MSCIMSCI Inc.The stock dropped after MSCI missed Q2 2026 revenue and earnings estimates and raised its full-year operating expense forecast.CHRWC.H. Robinson Worldwide, Inc.CHRW fell 9.25% after disclosing a $604M advisory jury verdict in a Texas fatal trucking accident lawsuit.WSTWest Pharmaceutical Services, Inc.The stock fell due to post-earnings profit taking and concerns over sequential revenue deceleration in Q3 guidance.
Notable Outliers
Earnings Divergence and Operational Stumbles
PNRPentair plcPentair stock plunged following a Q2 earnings miss, slashed 2026 guidance due to pool channel destocking, and an abrupt CFO departure.HASHasbro, Inc.Hasbro stock surged after Q2 2026 earnings and revenue beat estimates, fueled by Wizards of the Coast growth and raised full-year guidance.ABTAbbott LaboratoriesAbbott stock surged after Q2 2026 earnings beat estimates and management raised full-year EPS guidance.MRNAModerna, Inc.The stock fell due to Wall Street downgrades, pre-earnings de-risking, high valuation multiples, and a looming $950M settlement payment.DHRDanaher CorporationDanaher deferred over $100M in bioprocessing revenue into 2027 and cut segment guidance despite beating Q2 estimates.MSCIMSCI Inc.MSCI fell after missing Q2 earnings estimates and raising its full-year 2026 operating expense guidance.
Earnings Shocks and Sector Rotations
IBMInternational Business Machines CorporationIBM issued a preliminary Q2 2026 profit warning and missed expectations as clients shifted IT budgets away from software to AI hardware.PNRPentair plcPentair cut FY26 guidance, reported weak preliminary Q2 earnings due to pool channel destocking, and announced its CFO's resignation.ISRGIntuitive Surgical, Inc.The stock fell due to slowing U.S. procedure growth and unchanged full-year guidance despite strong Q2 earnings and revenue beats.TRVThe Travelers Companies, Inc.Travelers surged after posting Q2 2026 Core EPS of $10.04, an 85.6% beat, driven by reduced catastrophe losses and strong underwriting.NFLXNetflix, Inc.Netflix stock fell due to disappointing Q3 revenue guidance and reduced transparency on viewing-hours reporting.
Standout Earnings, Upgrades, and One-Offs
VOD.LVodafone Group Public Limited CompanyVodafone stock surged following Xavier Niel's £4.4B stake acquisition and UK clearance to take 100% control of its joint venture.APPAppLovin CorporationAppLovin fell after a BofA report showed slowing June e-commerce advertiser sign-ups, compounded by tech selling and insider sales.AXONAxon Enterprise, Inc.The stock fell due to profit-taking following a 40% rally, CEO insider sale disclosures, and negative technical signals.MPCMarathon Petroleum CorporationMPC surged due to record refining crack spreads from Middle East disruptions and a UBS Q2 EPS estimate upgrade to $14.49.GSThe Goldman Sachs Group, Inc.Goldman Sachs beat Q2 2026 earnings expectations with EPS of $20.98 vs $14.51 expected and record net revenues of $20.34 billion.CVNACarvana Co.Jefferies reiterated a Buy rating with a $90 price target, triggering pre-earnings buying and short-covering.PSON.LPearson plcJPMorgan downgraded the stock from Overweight to Neutral due to valuation exhaustion following a 28% year-to-date rally.
Notable Idiosyncratic Movers
MRNAModerna, Inc.Moderna fell due to a JPMorgan short call, lowered respiratory vaccine guidance, and a $950 million patent litigation payout.STJ.LSt. James's Place plcThe stock fell due to the exit of top partner Sovereign Wealth to a rival and a Barclays downgrade citing AI-driven fee compression.AXONAxon Enterprise, Inc.The stock dropped 12.10% due to profit-taking following a political rally, CEO insider selling, and technical mean-reversion.VOD.LVodafone Group Public Limited CompanyXavier Niel's firm agreed to buy a 16.2% stake in Vodafone for £4.4B, driving strong buying momentum and analyst upgrades.
UK Blue-Chip Disruptions
VOD.LVodafone Group Public Limited CompanyXavier Niel's Vega agreed to buy a 16.2% stake in Vodafone for £4.4 billion from Emirates Telecommunications Group.AZN.LAstraZeneca PLCAstraZeneca stock fell after its Phase III trial for heart disease drug Wainua failed to meet its primary endpoint.STJ.LSt. James's Place plcReports revealed major partner practice Sovereign Wealth is in talks to exit SJP and join competitor Söderberg & Partners.
Notable Single-Stock Disconnects
FDXFFedEx Freight Holding Company, Inc.The stock surged following a Stephens & Co. Buy initiation and the execution of parent company FedEx's $4.15B debt tender offer.AZN.LAstraZeneca PLCAstraZeneca's Phase III CARDIO-TTRansform trial for Wainua failed to meet its primary endpoint in ATTR-CM patients.IVZInvesco Ltd.Invesco surged after releasing a June 2026 report showing record $2.47T AUM, driven by strong net inflows and market appreciation.
Notable Single-Stock Movers
SYFSynchrony FinancialShares fell after Federal Reserve data revealed an unexpected contraction in U.S. revolving consumer credit balances for May 2026.MRNAModerna, Inc.Morgan Stanley reiterated a Neutral rating with a $39 price target, sparking profit-taking over valuation concerns.SWSmurfit Westrock plcThe stock dropped due to reduced Q2 earnings estimates from higher OCC costs, a mill environmental inspection, and LSE delisting flows.AXONAxon Enterprise, Inc.Axon dropped due to profit-taking following a 40% rally, political scrutiny over an ICE contract, and a broad macro market sell-off.
Notable Standouts and One-Offs
AXONAxon Enterprise, Inc.Axon stock rallied on news of a Trump stock purchase linked to a $220M ICE contract notice and a Needham price target upgrade.CTSHCognizant Technology Solutions CorporationCognizant stock surged after announcing a major expansion of its strategic enterprise AI partnership with Google Cloud.OXYOccidental Petroleum CorporationThe stock surged due to a Middle East supply disruption driving crude prices higher and an Evercore ISI double upgrade to Outperform.PANWPalo Alto Networks, Inc.The stock fell due to an analyst downgrade to Hold, price target cuts, valuation concerns, and clustered insider sales.CBOECboe Global Markets, Inc.Cboe reported record June and Q2 trading volumes, with an all-time high monthly average daily volume of 23M options contracts.
Notable One-Offs
AXONAxon Enterprise, Inc.The stock surged following news of President Trump purchasing Axon stock shortly before ICE solicited a tailored $220M contract.MRNAModerna, Inc.Shares surged after a 9-0 FDA Advisory Committee vote backed its flu vaccine and a Science Day presentation revealed a new pipeline.SMCISuper Micro Computer, Inc.Taiwanese prosecutors raided Supermicro's offices over illegal server exports to China, compounding fears from a $7B equity raise.COINCoinbase Global, Inc.The stock surged due to institutional accumulation, Benchmark maintaining a Buy rating, a new Spiko partnership, and technical bounce.
Notable One-Offs
AXONAxon Enterprise, Inc.Disclosures showed President Trump bought AXON stock before ICE posted a $220M procurement notice matching TASER specifications.HRLHormel Foods CorporationHormel announced the sale of its Ceratti Brazil business with undisclosed terms, triggering market uncertainty and technical selling.
Corporate Catalysts and Governance Risks
SMCISuper Micro Computer, Inc.SMCI plummeted following Taiwan office raids investigating the alleged smuggling of export-restricted Nvidia AI chips to China.AXONAxon Enterprise, Inc.AXON stock surged after disclosures revealed Donald Trump bought shares shortly before an ICE $220M contract notice was posted.CHTRCharter Communications, Inc.Charter stock rose due to reports of SpaceX partnership talks and sector tailwinds from Comcast's corporate restructuring.TSLATesla, Inc.Tesla rolled out FSD v14 Lite to legacy Hardware 3 vehicles alongside analyst optimism ahead of Q2 vehicle delivery reports.CPRTCopart, Inc.Copart stock fell after CEO Jeff Liaw announced his resignation, with former CEO Jay Adair stepping back into the executive role.